General Information

  • ID:  hor004659
  • Uniprot ID:  O24567
  • Protein name:  CLAVATA3/ESR (CLE)-related protein ESR3
  • Gene name:  ESR3
  • Organism:  Zea mays (Maize)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [ESR3p]: Expressed specifically in the embryo surrounding region at the micropylar end of the seed endosperm at early stages (4 to 7 days after pollination, DAP) and ever-decreasing parts of the suspensor at subsequent stages (at protein level). |[ESR3p]:
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Zea (genus), Tripsacinae (subtribe), Andropogoneae (tribe), Andropogonodae, Panicoideae (subfamily), PACMAD clade, Poaceae (family), Poales (order), commelinids, Petrosaviidae (subclass), Liliopsida, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  NAWQTDDKPGVNRNMEMQQQQGGFIGHRPRLASFNRASNQEGDRKRTVPSGPNHKHNNIPSHTPHHPPSYVQALYEDDRTITSPGPSKSIGPPPLPDRY
  • Length:  99
  • Propeptide:  MASRMGMVAIMSLFVYAIVVPTSVNANAWQTDDKPGVNRNMEMQQQQGGFIGHRPRLASFNRASNQEGDRKRTVPSGPNHKHNNIPSHTPHHPPSYVQALYEDDRTITSPGPSKSIGPPPLPDRY
  • Signal peptide:  MASRMGMVAIMSLFVYAIVVPTSVNA
  • Modification:  T49 Hydroxyproline;T52 Hydroxyproline
  • Glycosylation:  T52 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signal peptide that regulates cell fate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O24567-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004659_AF2.pdbhor004659_ESM.pdb

Physical Information

Mass: 1286333 Formula: C479H737N155O149S2
Absent amino acids: C Common amino acids: P
pI: 10.05 Basic residues: 18
Polar residues: 32 Hydrophobic residues: 17
Hydrophobicity: -137.88 Boman Index: -30033
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 40.4
Instability Index: 4871.01 Extinction Coefficient cystines: 9970
Absorbance 280nm: 101.73

Literature

  • PubMed ID:  12096094
  • Title:  Esr Proteins Are Secreted by the Cells of the Embryo Surrounding Region